PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00010727-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 173aa    MW: 19736.1 Da    PI: 6.1072
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00010727-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.4e-181663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT eEd +lv++++ +G g W+t a+  g++Rt+k+c++rw++yl
  WALNUT_00010727-RA 16 KGPWTMEEDMILVNYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYL 63
                        79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-21966IPR009057Homeodomain-like
PROSITE profilePS5129420.7411167IPR017930Myb domain
SMARTSM007172.0E-121565IPR001005SANT/Myb domain
SuperFamilySSF466899.22E-201683IPR009057Homeodomain-like
PfamPF002495.1E-161663IPR001005SANT/Myb domain
CDDcd001674.63E-111863No hitNo description
Gene3DG3DSA:1.10.10.601.8E-76792IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MDKKPCNSSQ DAEVRKGPWT MEEDMILVNY IANHGEGVWN TLAKSAGLKR TGKSCRLRWL  60
NYLRPDHLPG RTDNEIKNYW RTRIQKHIKQ AENLYGQSSS SVVMNDQTGS SISQVTAIGR  120
MDVDPLETYS PPSFQTNMDQ PIPAPHLPAP ESINDNYYWS MEDIWSMQLF GGD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879077.17e-77PREDICTED: myb-related protein 305-like
SwissprotP813912e-64MYB05_ANTMA; Myb-related protein 305
TrEMBLW8CLI77e-75W8CLI7_TOBAC; Transcription factor MYB305
STRINGSolyc02g067760.2.13e-72(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.15e-55myb domain protein 21